Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPEM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 203-309 of human SPEM1 (NP_955371.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPEM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 203-309 of human SPEM1 (NP_955371.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01793A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPEM1 |
| Target Synonyms | C17orf83; SPEM1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | PC-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 203-309 of human SPEM1 (NP_955371.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YVYPVNPPPPSPEAPSHKNGGEGAVPEAEAAQYQPVPAPTLGPAVIPEFSRHRSSGRIVYDARDMRRRLRELTREVEALSGCYPLASGSSTAEETSKNWVYRSLTGR | Uniprot ID | Q8N4L4 |
Uniprot Id
Q8N4L4
Target Species
Human
Target Name
SPEM1
Target Full Name
Spermatid maturation protein 1
Target Function
Required for proper cytoplasm removal during spermatogenesis.
Target Subcellular Location
Membrane; Single-pass membrane protein. Cytoplasm.
Target Synonyms
SPEM1; C17orf83; Spermatid maturation protein 1
Target Background
Predicted to be involved in flagellated sperm motility and sperm individualization. Predicted to act upstream of or within spermatogenesis. Predicted to be integral component of membrane. Predicted to be active in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
