Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Spermine synthase was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human Spermine synthase (P52788) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Spermine synthase was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human Spermine synthase (P52788) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15852A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Spermine synthase |
| Target Synonyms | SRS; SpS; MRSR; SPMSY; MRXSSR; Spermine synthase | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, DU-145, Mouse brain, Mouse skeletal muscle, Mouse spinal cord, Rat thymus, Rat uterus, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Spermine synthase (P52788). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNI | Uniprot ID | P52788 |
Uniprot Id
P52788
Target Species
Human
Target Name
SMS
Target Full Name
Spermine synthase
Target Function
Catalyzes the production of spermine from spermidine and decarboxylated S-adenosylmethionine (dcSAM).
Target Involvement
X-linked syndromic mental retardation Snyder-Robinson type (MRXSSR)
Target Protein Families
Spermidine/spermine synthase family
Target Synonyms
MRSR; SMS; Snyder Robinson X linked mental retardation syndrome; Spermidine aminopropyltransferase; Spermine synthase; SPMSY; SpS; SPSY_HUMAN; SRS
Target Background
This gene encodes a protein belonging to the spermidine/spermin synthase family and catalyzes the production of spermine from spermidine. Pseudogenes of this gene are located on chromosomes 1, 5, 6 and X. Mutations in this gene cause an X-linked intellectual disability called Snyder-Robinson Syndrome (SRS). Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
