-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPINK5 / LEKTI was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human SPINK5 / LEKTI (Q9NQ38) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPINK5 / LEKTI was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human SPINK5 / LEKTI (Q9NQ38) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13345A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPINK5 / LEKTI |
| Target Synonyms | NS; NETS; LEKTI; LETKI; VAKTI; SPINK5 / LEKTI | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7, Mouse skin, Mouse stomach, Rat stomach, RAW264.7 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SPINK5 / LEKTI (Q9NQ38). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FKKGERDGDFICPDYYEAVCGTDGKTYDNRCALCAENAKTGSQIGVKSEGECKSSNPEQDVCSAFRPFVRDGRLGCTRENDPVLGPDGKTHGNKCAMCAEL | Uniprot ID | Q9NQ38 |
Uniprot Id
Q9NQ38
Target Species
Human
Target Name
SPINK5
Target Full Name
Serine protease inhibitor Kazal-type 5
Target Function
Serine protease inhibitor, probably important for the anti-inflammatory and/or antimicrobial protection of mucous epithelia. Contribute to the integrity and protective barrier function of the skin by regulating the activity of defense-activating and desquamation-involved proteases. Inhibits KLK5, it's major target, in a pH-dependent manner. Inhibits KLK7, KLK14 CASP14, and trypsin.
Target Involvement
Netherton syndrome (NETH)
Target Subcellular Location
Secreted.
Target Tissue Specificity
Highly expressed in the thymus and stratum corneum. Also found in the oral mucosa, parathyroid gland, Bartholin's glands, tonsils, and vaginal epithelium. Very low levels are detected in lung, kidney, and prostate.
Target Research Area
Cell Biology
Target Synonyms
Hemofiltrate peptide HF7665; ISK5_HUMAN; LEKTI; Lympho-epithelial Kazal-type-related inhibitor; Lymphoepithelial Kazal type related inhibitor; NETS; NS; Serine peptidase inhibitor Kazal type 5; SPINK5; VAKTI
Target Background
This gene encodes a multidomain serine protease inhibitor that contains 15 potential inhibitory domains. The encoded preproprotein is proteolytically processed to generate multiple protein products, which may exhibit unique activities and specificities. These proteins may play a role in skin and hair morphogenesis, as well as anti-inflammatory and antimicrobial protection of mucous epithelia. Mutations in this gene may result in Netherton syndrome, a disorder characterized by ichthyosis, defective cornification, and atopy. This gene is present in a gene cluster on chromosome 5. Alternative splicing results in multiple transcript variants.
Notification