-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPOP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-374 of human SPOP (NP_001007227.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPOP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-374 of human SPOP (NP_001007227.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02171A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPOP |
| Target Synonyms | TEF2; BTBD32; NSDVS1; NSDVS2; NEDMACE; NEDMIDF; SPOP | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 220-374 of human SPOP (NP_001007227.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS | Uniprot ID | O43791 |
Uniprot Id
O43791
Target Species
Human
Target Name
SPOP
Target Full Name
Speckle-type POZ protein
Target Function
Component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination of target proteins, leading most often to their proteasomal degradation. In complex with CUL3, involved in ubiquitination and proteasomal degradation of BRMS1, DAXX, PDX1/IPF1, GLI2 and GLI3. In complex with CUL3, involved in ubiquitination of MACROH2A1 and BMI1; this does not lead to their proteasomal degradation. Inhibits transcriptional activation of PDX1/IPF1 targets, such as insulin, by promoting PDX1/IPF1 degradation. The cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex containing homodimeric SPOP has higher ubiquitin ligase activity than the complex that contains the heterodimer formed by SPOP and SPOPL. Involved in the regulation of bromodomain and extra-terminal motif (BET) proteins BRD2, BRD3, BRD4 stability.
Target Subcellular Location
Nucleus. Nucleus speckle.
Target Protein Families
Tdpoz family
Target Tissue Specificity
Widely expressed.
Target Synonyms
BTBD32; HIB homolog 1; Roadkill homolog 1; Speckle type POZ protein; Speckle-type POZ protein; SPOP; SPOP_HUMAN; TEF 2; TEF2
Target Background
This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein.
Notification