Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-261 of human SPR (P35270) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-261 of human SPR (P35270) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01869A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPR |
| Target Synonyms | SDR38C1; SPR | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, COS-7, HepG2, Jurkat, MCF7, Mouse liver, Mouse pancreas, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-261 of human SPR (P35270). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK | Uniprot ID | P35270 |
Uniprot Id
P35270
Target Species
Human
Target Name
SPR
Target Full Name
Sepiapterin reductase
Target Function
Catalyzes the final one or two reductions in tetra-hydrobiopterin biosynthesis to form 5,6,7,8-tetrahydrobiopterin.
Target Involvement
Dystonia, DOPA-responsive, due to sepiapterin reductase deficiency (DRDSPRD)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Sepiapterin reductase family
Target Research Area
Signal Transduction
Target Synonyms
OTTHUMP00000160199; SDR38C1; Sepiapterin reductase (7,8 dihydrobiopterin:NADP+ oxidoreductase); Sepiapterin reductase; Short chain dehydrogenase/reductase family 38C, member 1; SPR; SPRE_HUMAN
Target Background
This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
