Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPRY4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-210 of human SPRY4 (NP_112226.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPRY4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-210 of human SPRY4 (NP_112226.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03115A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPRY4 |
| Target Synonyms | HH17; SPRY4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, HepG2, SW480, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-210 of human SPRY4 (NP_112226.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLALTTGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECL | Uniprot ID | Q9C004 |
Uniprot Id
Q9C004
Target Species
Human
Target Name
SPRY4
Target Full Name
Protein sprouty homolog 4
Target Function
Suppresses the insulin receptor and EGFR-transduced MAPK signaling pathway, but does not inhibit MAPK activation by a constitutively active mutant Ras. Probably impairs the formation of GTP-Ras. Inhibits Ras-independent, but not Ras-dependent, activation of RAF1. Represses integrin-mediated cell spreading via inhibition of TESK1-mediated phosphorylation of cofilin.
Target Involvement
Hypogonadotropic hypogonadism 17 with or without anosmia (HH17)
Target Subcellular Location
Cytoplasm. Cell projection, ruffle membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
Sprouty family
Target Synonyms
Protein sprouty homolog 4; Sprouty 4; Sprouty homolog 4; sprouty homolog 4 (Drosophila); SPRY 4; Spry-4; Spry4; SPY4_HUMAN
Target Background
This gene encodes a member of a family of cysteine- and proline-rich proteins. The encoded protein is an inhibitor of the receptor-transduced mitogen-activated protein kinase (MAPK) signaling pathway. Activity of this protein impairs the formation of active GTP-RAS. Nucleotide variation in this gene has been associated with hypogonadotropic hypogonadism 17 with or without anosmia. Alternative splicing results in a multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
