-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPTLC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 423-562 of human SPTLC2 (NP_004854.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPTLC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 423-562 of human SPTLC2 (NP_004854.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09217A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPTLC2 |
| Target Synonyms | LCB2; SPT2; HSN1C; LCB2A; NSAN1C; hLCB2a; SPTLC2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, BxPC-3, Mouse stomach, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 423-562 of human SPTLC2 (NP_004854.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKCIMGQDGTSLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRLVPLLDRPFDETTYEETED | Uniprot ID | O15270 |
Uniprot Id
O15270
Target Species
Human
Target Name
SPTLC2
Target Full Name
Serine palmitoyltransferase 2
Target Function
Serine palmitoyltransferase (SPT). The heterodimer formed with LCB1/SPTLC1 constitutes the catalytic core. The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC2-SPTSSA complex shows a strong preference for C16-CoA substrate, while the SPTLC1-SPTLC2-SPTSSB complex displays a preference for C18-CoA substrate. Plays an important role in de novo sphyngolipid biosynthesis which is crucial for adipogenesis.
Target Involvement
Neuropathy, hereditary sensory and autonomic, 1C (HSAN1C)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Target Protein Families
Class-II pyridoxal-phosphate-dependent aminotransferase family
Target Tissue Specificity
Widely expressed.
Target Research Area
Cancer
Target Synonyms
KIAA0526; LCB 2; LCB2; LCB2a; Long chain base biosynthesis protein 2; Long chain base biosynthesis protein 2a; Serine palmitoyl CoA transferase 2; Serine palmitoyltransferase 2; Serine palmitoyltransferase long chain base subunit 2; Serine palmitoyltransferase subunit II; Serine-palmitoyl-CoA transferase 2; SPT 2; SPT2; SPTC2_HUMAN; SPTLC 2; Sptlc2
Target Background
This gene encodes a long chain base subunit of serine palmitoyltransferase. Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It catalyzes the pyridoxal-5-prime-phosphate-dependent condensation of L-serine and palmitoyl-CoA to 3-oxosphinganine. Mutations in this gene were identified in patients with hereditary sensory neuropathy type I.
Notification