Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SQLE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human SQLE (NP_003120.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SQLE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human SQLE (NP_003120.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-04360A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SQLE |
| Target Synonyms | SQLE | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human SQLE (NP_003120.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VSVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDIRGEMPRNLREYMVEKIYPQIPDHLKEPFLEATDNSHLRSMPASFLPPSSVKK | Uniprot ID | Q14534 |
Uniprot Id
Q14534
Target Species
Human
Target Name
SQLE
Target Full Name
Squalene monooxygenase
Target Function
Catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene, and is considered to be a rate-limiting enzyme in steroid biosynthesis.
Target Subcellular Location
Microsome membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Peripheral membrane protein.
Target Protein Families
Squalene monooxygenase family
Target Tissue Specificity
Detected in liver (at protein level).
Target Research Area
Cancer
Target Synonyms
SQLE; ERG1; Squalene monooxygenase; Squalene epoxidase; SE
Target Background
Enables FAD binding activity and squalene monooxygenase activity. Involved in lipid droplet formation; regulation of cell population proliferation; and sterol biosynthetic process. Located in intracellular membrane-bounded organelle. Is integral component of membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
