Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SQS/FDFT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human SQS/FDFT1 (P37268) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SQS/FDFT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human SQS/FDFT1 (P37268) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15813A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SQS/FDFT1 |
| Target Synonyms | SS; SQS; DGPT; ERG9; SQSD; SQS/FDFT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, A-549, Rat liver, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SQS/FDFT1 (P37268). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPE | Uniprot ID | P37268 |
Uniprot Id
P37268
Target Species
Human
Target Name
FDFT1
Target Full Name
Squalene synthase
Target Function
Catalyzes the condensation of 2 farnesyl pyrophosphate (FPP) moieties to form squalene. Proceeds in two distinct steps. In the first half-reaction, two molecules of FPP react to form the stable presqualene diphosphate intermediate (PSQPP), with concomitant release of a proton and a molecule of inorganic diphosphate. In the second half-reaction, PSQPP undergoes heterolysis, isomerization, and reduction with NADPH or NADH to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Phytoene/squalene synthase family
Target Tissue Specificity
Widely expressed.
Target Research Area
Metabolism
Target Synonyms
DGPT; ERG9; Farnesyl diphosphate farnesyltransferase; Farnesyl-diphosphate farnesyltransferase; FDFT_HUMAN; FDFT1; FPP:FPP farnesyltransferase; SQS; Squalene synthase; Squalene synthetase; SS
Target Background
This gene encodes a membrane-associated enzyme located at a branch point in the mevalonate pathway. The encoded protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
