-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SR-BI was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SR-BI (Q8WTV0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SR-BI was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SR-BI (Q8WTV0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16771A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SR-BI |
| Target Synonyms | CLA1; SRB1; CLA-1; SR-BI; CD36L1; HDLCQ6; HDLQTL6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, Mouse liver, Mouse ovary, Rat liver, Rat ovary | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SR-BI (Q8WTV0). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHK | Uniprot ID | Q8WTV0 |
Uniprot Id
Q8WTV0
Target Species
Human
Target Name
SCARB1
Target Full Name
Scavenger receptor class B member 1
Target Function
Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells. Receptor for HDL, mediating selective uptake of cholesteryl ether and HDL-dependent cholesterol efflux. Also facilitates the flux of free and esterified cholesterol between the cell surface and apoB-containing lipoproteins and modified lipoproteins, although less efficiently than HDL. May be involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity.; (Microbial infection) Acts as a receptor for hepatitis C virus in hepatocytes and appears to facilitate its cell entry. Binding between SCARB1 and the hepatitis C virus glycoprotein E2 is independent of the genotype of the viral isolate.; (Microbial infection) Mediates uptake of M.fortuitum, E.coli and S.aureus.; (Microbial infection) Facilitates the entry of human coronavirus SARS-CoV-2 by acting as an entry cofactor through HDL binding.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane, caveola; Multi-pass membrane protein. Note=Predominantly localized to cholesterol and sphingomyelin-enriched domains within the plasma membrane, called caveolae.
Target Protein Families
CD36 family
Target Tissue Specificity
Widely expressed.
Target Research Area
Cancer
Target Synonyms
CD36 and LIMPII analogous 1; CD36; CD36 Antigen like 1; CD36 antigen-like 1; CD36L1; CLA 1; CLA-1; CLA1; Collagen type I receptor; HDLQTL6; MGC138242; SCARB1; Scavebger Receptor Class B Member 1; Scavenger receptor class B member 1; Scavenger Receptor Class B Type 1; SCRB1_HUMAN; SR BI; SR-BI; SRB1; SRBI; Thrombospondin receptor like 1; thrombospondin receptor-like 1
Target Background
The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2 and facilitates cell entry by the virus, SARS-CoV2.
Notification