Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SREK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SREK1 (NP_631907.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SREK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SREK1 (NP_631907.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03540A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SREK1 |
| Target Synonyms | SFRS12; SRrp86; SRrp508; SREK1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SREK1 (NP_631907.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLNSQTTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPE | Uniprot ID | Q8WXA9 |
Uniprot Id
Q8WXA9
Target Species
Human
Target Name
SREK1
Target Full Name
Splicing regulatory glutamine/lysine-rich protein 1
Target Function
Participates in the regulation of alternative splicing by modulating the activity of other splice facors. Inhibits the splicing activity of SFRS1, SFRS2 and SFRS6. Augments the splicing activity of SFRS3.
Target Subcellular Location
Nucleus.
Target Protein Families
Splicing factor SR family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
SREK1; SFRS12; SRRP86Splicing regulatory glutamine/lysine-rich protein 1; Serine/arginine-rich-splicing regulatory protein 86; SRrp86; Splicing factor; arginine/serine-rich 12; Splicing regulatory protein 508; SRrp508
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
