Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRSF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF2 (NP_001182356.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SRSF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF2 (NP_001182356.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11242A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRSF2 |
| Target Synonyms | SC35; PR264; SC-35; SFRS2; SFRS2A; SRp30b; SRSF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Raji, THP-1 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF2 (NP_001182356.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHH | Uniprot ID | Q01130 |
Uniprot Id
Q01130
Target Species
Human
Target Name
SRSF2
Target Full Name
Serine/arginine-rich splicing factor 2
Target Function
Necessary for the splicing of pre-mRNA. It is required for formation of the earliest ATP-dependent splicing complex and interacts with spliceosomal components bound to both the 5'- and 3'-splice sites during spliceosome assembly. It also is required for ATP-dependent interactions of both U1 and U2 snRNPs with pre-mRNA. Interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Binds to purine-rich RNA sequences, either 5'-AGSAGAGTA-3' (S=C or G) or 5'-GTTCGAGTA-3'. Can bind to beta-globin mRNA and commit it to the splicing pathway. The phosphorylated form (by SRPK2) is required for cellular apoptosis in response to cisplatin treatment.
Target Subcellular Location
Nucleus. Nucleus, nucleoplasm. Nucleus speckle. Note=Phosphorylation by SRPK2 provokes its redistribution from the nuclear speckle to nucleoplasm.
Target Protein Families
Splicing factor SR family
Target Synonyms
35 kDa; arginine/serine-rich 2; PR264; Protein PR264; SC 35; SC-35; SC35; Serine/arginine-rich splicing factor 2; SFRS 2; SFRS2; SFRS2A; Splicing component 35 kDa; Splicing component; Splicing factor; Splicing factor arginine/serine rich 2; Splicing factor SC35; Splicing speckle; Splicing speckles; SR splicing factor 2; SRp30b; SRSF2; SRSF2_HUMAN
Target Background
The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants encoding the same protein and one non-coding transcript variant have been found for this gene. In addition, a pseudogene of this gene has been found on chromosome 11.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
