-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRSF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF3 (P84103) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SRSF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF3 (P84103) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16143A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRSF3 |
| Target Synonyms | SFRS3; SRp20; SRSF3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse brain, Rat spleen, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF3 (P84103). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRP | Uniprot ID | P84103 |
Uniprot Id
P84103
Target Species
Human
Target Name
SRSF3
Target Full Name
Serine/arginine-rich splicing factor 3
Target Function
Splicing factor that specifically promotes exon-inclusion during alternative splicing. Interaction with YTHDC1, a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A)-containing RNAs, promotes recruitment of SRSF3 to its mRNA-binding elements adjacent to m6A sites, leading to exon-inclusion during alternative splicing. Also functions as export adapter involved in mRNA nuclear export. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway); enhances NXF1-NXT1 RNA-binding activity. Involved in nuclear export of m6A-containing mRNAs via interaction with YTHDC1: interaction with YTHDC1 facilitates m6A-containing mRNA-binding to both SRSF3 and NXF1, promoting mRNA nuclear export. RNA-binding is semi-sequence specific.
Target Subcellular Location
Nucleus. Nucleus speckle. Cytoplasm.
Target Protein Families
Splicing factor SR family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
arginine/serine-rich 3; Pre mRNA splicing factor SRP20; Pre-mRNA-splicing factor SRP20; Serine/arginine-rich splicing factor 3; Splicing factor; Splicing factor arginine/serine rich 20 kD ; Splicing factor arginine/serine rich 3 ; SRp20; SRSF3; SRSF3_HUMAN; X16
Target Background
The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants, one protein-coding and the other non-coding, have been found for this gene.
Notification