Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRSF8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF8 (NP_115285.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SRSF8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF8 (NP_115285.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00654A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRSF8 |
| Target Synonyms | DSM-1; SRP46; SFRS2B; SRSF8 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF8 (NP_115285.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLPRS | Uniprot ID | Q9BRL6 |
Uniprot Id
Q9BRL6
Target Species
Human
Target Name
SRSF8
Target Full Name
Serine/arginine-rich splicing factor 8
Target Function
Involved in pre-mRNA alternative splicing.
Target Subcellular Location
Nucleus.
Target Protein Families
Splicing factor SR family
Target Tissue Specificity
Strongly expressed in pancreas, spleen and prostate. Weakly expressed in lung, liver and thymus.
Target Synonyms
SRSF8; SFRS2B; SRP46Serine/arginine-rich splicing factor 8; Pre-mRNA-splicing factor SRP46; Splicing factor SRp46; Splicing factor; arginine/serine-rich 2B
Target Background
This gene encodes a member of a family of proteins containing a ribonucleoprotein (RNP)-type RNA binding motif and a carboxyl-terminal arginine-serine-rich (RS) domain. The encoded protein functions as a pre-mRNA splicing factor. There is a pseudogene for this gene on chromosome 7. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
