Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SSCA1/SerpinB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-390 of human SSCA1/SerpinB3 (P29508) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against SSCA1/SerpinB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-390 of human SSCA1/SerpinB3 (P29508) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of SSCA1/SerpinB3 in paraffin-embedded Mouse skin using SSCA1/SerpinB3 Rabbit mAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Cat.No | ADA-14465A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SSCA1/SerpinB3 |
| Target Synonyms | SCC; T4-A; SCCA1; SSCA1; SCCA-1; HsT1196; SCCA-PD; SSCA1/SerpinB3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 301-390 of human SSCA1/SerpinB3 (P29508). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP | Uniprot ID | P29508 |
Uniprot Id
P29508
Target Species
Human
Target Name
SERPINB3
Target Full Name
Serpin B3
Target Function
May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).
Target Subcellular Location
Cytoplasm. Note=Seems to also be secreted in plasma by cancerous cells but at a low level.
Target Protein Families
Serpin family, Ov-serpin subfamily
Target Tissue Specificity
Squamous cells. Expressed in some hepatocellular carcinoma (at protein level).
Target Synonyms
SCC; T4-A; SCCA1; SSCA1; SCCA-1; HsT1196; SCCA-PD; SSCA1/SerpinB3
Target Background
Enables cysteine-type endopeptidase inhibitor activity; protease binding activity; and virus receptor activity. Involved in several processes, including autocrine signaling; paracrine signaling; and regulation of cellular protein metabolic process. Located in cytoplasmic vesicle; extracellular exosome; and nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
