Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SSR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-145 of human SSR2 (NP_003136.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SSR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-145 of human SSR2 (NP_003136.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09828A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SSR2 |
| Target Synonyms | TLAP; HSD25; TRAPB; TRAP-BETA; SSR2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HepG2, Mouse liver, Mouse pancreas, Rat liver, Rat pancreas, SKOV3 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 18-145 of human SSR2 (NP_003136.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSP | Uniprot ID | P43308 |
Uniprot Id
P43308
Target Species
Human
Target Name
SSR2
Target Full Name
Translocon-associated protein subunit beta
Target Function
TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Target Protein Families
TRAP-beta family
Target Synonyms
SSR2; TRAPB; HSD25; Translocon-associated protein subunit beta; TRAP-beta; Signal sequence receptor subunit beta; SSR-beta
Target Background
The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2). The human beta-signal sequence receptor gene (SSR2) maps to chromosome bands 1q21-q23.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
