-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SSTR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 314-388 of human SSTR4 (NP_001043.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SSTR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 314-388 of human SSTR4 (NP_001043.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02756A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SSTR4 |
| Target Synonyms | SS4R; SST4; SS4-R; SS-4-R; SSTR4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, BT-474, HepG2, HL-60, Mouse brain, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 314-388 of human SSTR4 (NP_001043.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF | Uniprot ID | P31391 |
Uniprot Id
P31391
Target Species
Human
Target Name
SSTR4
Target Full Name
Somatostatin receptor type 4
Target Function
Receptor for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. It is functionally coupled not only to inhibition of adenylate cyclase, but also to activation of both arachidonate release and mitogen-activated protein (MAP) kinase cascade. Mediates antiproliferative action of somatostatin in tumor cells.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Specifically expressed in fetal and adult brain, lung tissue, stomach, and in lesser quantities in the kidney, pituitary and adrenals.
Target Synonyms
SSTR4; Somatostatin receptor type 4; SS-4-R; SS4-R; SS4R
Target Background
Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR4 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in fetal and adult brain and lung.
Notification