Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SSX4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-188 of human SSX4 (NP_005627.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SSX4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-188 of human SSX4 (NP_005627.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01868A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SSX4 |
| Target Synonyms | CT5.4; SSX4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 70-188 of human SSX4 (NP_005627.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE | Uniprot ID | O60224 |
Uniprot Id
O60224
Target Species
Human
Target Name
SSX4
Target Full Name
Protein SSX4
Target Function
Could act as a modulator of transcription.
Target Protein Families
SSX family
Target Research Area
Others
Target Synonyms
Cancer/testis antigen 5.4; CT5.4; MGC12411; Protein SSX4; SSX4_HUMAN; SSX4B; Synovial sarcoma X breakpoint 4
Target Background
The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4, represents the more telomeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
