Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ST6GALNAC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human ST6GALNAC4 (NP_778204.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ST6GALNAC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human ST6GALNAC4 (NP_778204.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03307A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ST6GALNAC4 |
| Target Synonyms | IV; SIAT3C; SIAT7D; SIAT3-C; SIAT7-D; ST6GalNAc; ST6GALNACIV; ST6GALNAC4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human ST6GALNAC4 (NP_778204.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSF | Uniprot ID | Q9H4F1 |
Uniprot Id
Q9H4F1
Target Species
Human
Target Name
ST6GALNAC4
Target Full Name
Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase
Target Function
Transfers the sialyl group (N-acetyl-alpha-neuraminyl or NeuAc) from CMP-NeuAc to the GalNAc residue on the NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc sequence of glycoproteins and glycolipids forming an alpha-2,6-linkage. Produces branched type disialyl structures by transfer of a sialyl group onto a GalNAc residue inside the backbone core chains. Prefers O-glycans to glycoproteins or glycolipids.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 29 family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
3-Gal-beta-1; 3-GalNAc-alpha-2; 6-sialyltransferase; Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase; NeuAc-alpha-2; SIA7D_HUMAN; Sialyltransferase 3C; Sialyltransferase 7D; SIAT3-C; SIAT3C; SIAT7-D; SIAT7D; ST6GalNAc IV; St6galnac4; ST6GalNAcIV
Target Background
The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein prefers glycoproteins rather than glycolipids as substrates and shows restricted substrate specificity, utilizing only the trisaccharide sequence Neu5Ac-alpha-2, 3-Gal-beta-1, 3-GalNAc. In addition, it is involved in the synthesis of ganglioside GD1A from GM1B. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Transcript variants encoding different isoforms have been found for this gene. Readthrough transcripts exist for this gene and the downstream ST6GALNAC6 gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
