-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STAMBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-270 of human STAMBP (NP_998787.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against STAMBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-270 of human STAMBP (NP_998787.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-02705A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STAMBP |
| Target Synonyms | AMSH; MICCAP; STAMBP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, HepG2, MCF7, Mouse brain, Rat liver, Rat lung, SW480 | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-270 of human STAMBP (NP_998787.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQL | Uniprot ID | O95630 |
Uniprot Id
O95630
Target Species
Human
Target Name
STAMBP
Target Full Name
STAM-binding protein
Target Function
Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains. Plays a role in signal transduction for cell growth and MYC induction mediated by IL-2 and GM-CSF. Potentiates BMP (bone morphogenetic protein) signaling by antagonizing the inhibitory action of SMAD6 and SMAD7. Has a key role in regulation of cell surface receptor-mediated endocytosis and ubiquitin-dependent sorting of receptors to lysosomes. Endosomal localization of STAMBP is required for efficient EGFR degradation but not for its internalization. Involved in the negative regulation of PI3K-AKT-mTOR and RAS-MAP signaling pathways.
Target Involvement
Microcephaly-capillary malformation syndrome (MICCAP)
Target Subcellular Location
Nucleus. Membrane; Peripheral membrane protein. Cytoplasm. Early endosome.
Target Protein Families
Peptidase M67C family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
AMSH; Associated molecule with the SH3 domain of STAM; Endosome associated ubiquitin isopeptidase; Endosome-associated ubiquitin isopeptidase; MGC126516; MGC126518; MICCAP; STABP_HUMAN; STAM binding protein; STAM-binding protein; Stambp
Target Background
Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.
Notification