Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STARD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human STARD4 (NP_001294986.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STARD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human STARD4 (NP_001294986.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04719A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STARD4 |
| Target Synonyms | STARD4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human STARD4 (NP_001294986.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGPCRLDWDSLMTSLDILENFEENCCVMR | Uniprot ID | Q96DR4 |
Uniprot Id
Q96DR4
Target Species
Human
Target Name
STARD4
Target Full Name
StAR-related lipid transfer protein 4
Target Function
Involved in the intracellular transport of cholesterol. Binds cholesterol or other sterols.
Target Synonyms
4632419C16Rik; 9030213J02Rik; AA517649; AW324468; StAR related lipid transfer (START) domain containing 4; StAR-related lipid transfer protein 4; STAR4_HUMAN; StARD4; START domain containing 4 sterol regulated; START domain-containing protein 4
Target Background
Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD4 (Soccio et al., 2002 [PubMed 12011452]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
