-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Stathmin 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Stathmin 1 (NP_005554.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Stathmin 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Stathmin 1 (NP_005554.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-08638A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Stathmin 1 |
| Target Synonyms | Lag; SMN; OP18; PP17; PP19; PR22; LAP18; C1orf215; Stathmin 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus, Rat thymus, SW620 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Stathmin 1 (NP_005554.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEK | Uniprot ID | P16949 |
Uniprot Id
P16949
Target Species
Human
Target Name
STMN1
Target Full Name
Stathmin
Target Function
Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Stathmin family
Target Tissue Specificity
Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at subs
Target Synonyms
C1orf215; Lag; LAP 18; LAP18; Leukemia associated phosphoprotein p18; Leukemia-associated phosphoprotein p18; Metablastin; Oncoprotein 18; OP 18; Op18; p18; p19; Phosphoprotein 19; Phosphoprotein p19; pp17; pp19; PR22; Pr22 protein; Prosolin; Protein Pr22; SMN; Stathmin; Stathmin1; STMN 1; Stmn1; STMN1_HUMAN
Target Background
This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification