-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Staufen was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 478-577 of human Staufen (O95793) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Staufen was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 478-577 of human Staufen (O95793) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13884A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Staufen |
| Target Synonyms | STAU; PPP1R150; Staufen | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 478-577 of human Staufen (O95793). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGHVPHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC | Uniprot ID | O95793 |
Uniprot Id
O95793
Target Species
Human
Target Name
STAU1
Target Full Name
Double-stranded RNA-binding protein Staufen homolog 1
Target Function
Binds double-stranded RNA (regardless of the sequence) and tubulin. May play a role in specific positioning of mRNAs at given sites in the cell by cross-linking cytoskeletal and RNA components, and in stimulating their translation at the site.; (Microbial infection) Plays a role in virus particles production of many viruses including of HIV-1, HERV-K, ebola virus and influenza virus. Acts by interacting with various viral proteins involved in particle budding process.
Target Subcellular Location
Cytoplasm. Rough endoplasmic reticulum. Note=Localizes exclusively with the rough reticulum endoplasmic (RER).
Target Tissue Specificity
Widely expressed. Expressed in brain, pancreas, heart, skeletal muscles, liver, lung, kidney and placenta.
Target Synonyms
Double stranded RNA binding protein Staufen homolog 1; Double stranded RNA binding protein Staufen homolog; Double-stranded RNA-binding protein Staufen homolog 1; FLJ25010; MGC124588; PPP1R150; STAU; STAU1; STAU1_HUMAN; staufen; Staufen RNA binding protein (Drosophila); Staufen RNA binding protein homolog 1; Staufen, Drosophila, homolog of, 1; Staufen, RNA binding protein, homolog 1 (Drosophila); staufen-like
Target Background
Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation.
Notification