-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Steroidogenic factor-1 (SF-1/NR5A1) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 351-461 of human Steroidogenic factor-1 (SF-1/NR5A1) (Q13285) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Steroidogenic factor-1 (SF-1/NR5A1) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 351-461 of human Steroidogenic factor-1 (SF-1/NR5A1) (Q13285) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14352A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Steroidogenic factor-1 (SF-1/NR5A1) |
| Target Synonyms | ELP; SF1; FTZ1; POF7; SF-1; AD4BP; FTZF1; SPGF8; SRXX4; SRXY3; hSF-1; Steroidogenic factor-1 (SF-1/NR5A1) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Mouse ovary, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 351-461 of human Steroidogenic factor-1 (SF-1/NR5A1) (Q13285). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AQELVLQLLALQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT | Uniprot ID | Q13285 |
Uniprot Id
Q13285
Target Species
Human
Target Name
NR5A1
Target Full Name
Steroidogenic factor 1
Target Function
Transcriptional activator. Essential for sexual differentiation and formation of the primary steroidogenic tissues. Binds to the Ad4 site found in the promoter region of steroidogenic P450 genes such as CYP11A, CYP11B and CYP21B. Also regulates the AMH/Muellerian inhibiting substance gene as well as the AHCH and STAR genes. 5'-YCAAGGYC-3' and 5'-RRAGGTCA-3' are the consensus sequences for the recognition by NR5A1. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional activity. Binds phosphatidylcholine. Binds phospholipids with a phosphatidylinositol (PI) headgroup, in particular PI(3,4)P2 and PI(3,4,5)P3. Activated by the phosphorylation of NR5A1 by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation.
Target Involvement
46,XY sex reversal 3 (SRXY3); 46,XX sex reversal 4 (SRXX4); Adrenal insufficiency, NR5A1-related (AINR); Premature ovarian failure 7 (POF7); Spermatogenic failure 8 (SPGF8)
Target Subcellular Location
Nucleus.
Target Protein Families
Nuclear hormone receptor family, NR5 subfamily
Target Tissue Specificity
High expressed in the adrenal cortex, the ovary, the testis, and the spleen.
Target Research Area
Developmental Biology
Target Synonyms
NR5A1; AD4BP; FTZF1; SF1; Steroidogenic factor 1; SF-1; STF-1; hSF-1; Adrenal 4-binding protein; Fushi tarazu factor homolog 1; Nuclear receptor subfamily 5 group A member 1; Steroid hormone receptor Ad4BP
Target Background
The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect.
Notification