-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STK33 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 399-514 of human STK33 (Q9BYT3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against STK33 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 399-514 of human STK33 (Q9BYT3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14291A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STK33 |
| Target Synonyms | STK33 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 399-514 of human STK33 (Q9BYT3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KEWKNNPESVEENTTEEKNKPSTEEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAEIKGEMEKTPVTPSQGTATKYPAKSGALSRTKKKL | Uniprot ID | Q9BYT3 |
Uniprot Id
Q9BYT3
Target Species
Human
Target Name
STK33
Target Full Name
Serine/threonine-protein kinase 33
Target Function
Serine/threonine protein kinase which phosphorylates VIME. May play a specific role in the dynamic behavior of the intermediate filament cytoskeleton by phosphorylation of VIME. Not essential for the survival of KRAS-dependent AML cell lines.
Target Subcellular Location
Cytoplasm, perinuclear region.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, CaMK subfamily
Target Tissue Specificity
Highly expressed in testis, fetal lung and heart, followed by pituitary gland, kidney, interventricular septum, pancreas, heart, trachea, thyroid gland and uterus. Weak hybridization signals were observed in the following tissues: amygdala, aorta, esophag
Target Synonyms
Hypothetical protein FLJ35932; Serine threonine kinase 33; Serine/threonine kinase 33; Serine/threonine protein kinase 33; Serine/threonine-protein kinase 33; STK 33; Stk33; STK33_HUMAN
Target Background
Serine/threonine protein kinase (STK33) is a 524-residue kinase that belongs to the calcium/calmodulin-dependent family of kinases. STK33 exhibits differential expression in normal and malignant cancer tissue, including hepatocellular carcinoma. STK33 expression is required in the context of mutant KRAS, the most commonly mutated human oncogene, to maintain for cellular viability and proliferation. STK33 depletion via modulation of interacting proteins results in proteasome-mediated degradation of STK33 in human cancer cells, triggering apoptosis.
Notification