Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STRA13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human STRA13 (NP_659435.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STRA13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human STRA13 (NP_659435.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00872A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STRA13 |
| Target Synonyms | D9; MHF2; CENP-X; FAAP10; STRA13 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human STRA13 (NP_659435.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF | Uniprot ID | A8MT69 |
Uniprot Id
A8MT69
Target Species
Human
Target Name
CENPX
Target Full Name
Centromere protein X
Target Function
DNA-binding component of the Fanconi anemia (FA) core complex. Required for the normal activation of the FA pathway, leading to monoubiquitination of the FANCI-FANCD2 complex in response to DNA damage, cellular resistance to DNA cross-linking drugs, and prevention of chromosomal breakage. In complex with CENPS (MHF heterodimer), crucial cofactor for FANCM in both binding and ATP-dependent remodeling of DNA. Stabilizes FANCM. In complex with CENPS and FANCM (but not other FANC proteins), rapidly recruited to blocked forks and promotes gene conversion at blocked replication forks. In complex with CENPS, CENPT and CENPW (CENP-T-W-S-X heterotetramer), involved in the formation of a functional kinetochore outer plate, which is essential for kinetochore-microtubule attachment and faithful mitotic progression. As a component of MHF and CENP-T-W-S-X complexes, binds DNA and bends it to form a nucleosome-like structure. DNA-binding function is fulfilled in the presence of CENPS, with the following preference for DNA substates: Holliday junction > double-stranded > splay arm > single-stranded. Does not bind DNA on its own.
Target Subcellular Location
Nucleus. Chromosome, centromere. Chromosome, centromere, kinetochore.
Target Protein Families
CENP-X/MHF2 family
Target Synonyms
CENP X; CENP-X; CENPX; CENPX_HUMAN; Centromere protein X; FAAP10; FANCM interacting histone fold protein 2; FANCM-interacting histone fold protein 2; Fanconi anemia associated polypeptide of 10 kDa; Fanconi anemia-associated polypeptide of 10 kDa; MGC14480; Retinoic acid inducible gene D9 protein homolog; Retinoic acid-inducible gene D9 protein homolog; Stimulated by retinoic acid gene 13 protein homolog; STRA13
Target Background
Enables DNA binding activity. Contributes to double-stranded DNA binding activity. Involved in replication fork processing and resolution of meiotic recombination intermediates. Part of FANCM-MHF complex and Fanconi anaemia nuclear complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
