-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STRA6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 538-667 of human STRA6 (NP_071764.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STRA6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 538-667 of human STRA6 (NP_071764.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02183A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STRA6 |
| Target Synonyms | MCOPS9; MCOPCB8; PP14296; STRA6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 538-667 of human STRA6 (NP_071764.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LYNAIHLGQMDLSLLPPRAATLDPGYYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP | Uniprot ID | Q9BX79 |
Uniprot Id
Q9BX79
Target Species
Human
Target Name
STRA6
Target Full Name
Receptor for retinol uptake STRA6
Target Function
Functions as retinol transporter. Accepts all-trans retinol from the extracellular retinol-binding protein RBP4, facilitates retinol transport across the cell membrane, and then transfers retinol to the cytoplasmic retinol-binding protein RBP1. Retinol uptake is enhanced by LRAT, an enzyme that converts retinol to all-trans retinyl esters, the storage forms of vitamin A. Contributes to the activation of a signaling cascade that depends on retinol transport and LRAT-dependent generation of retinol metabolites that then trigger activation of JAK2 and its target STAT5, and ultimately increase the expression of SOCS3 and inhibit cellular responses to insulin. Important for the homeostasis of vitamin A and its derivatives, such as retinoic acid. STRA6-mediated transport is particularly important in the eye, and under conditions of dietary vitamin A deficiency. Does not transport retinoic acid.
Target Involvement
Microphthalmia, syndromic, 9 (MCOPS9)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Tissue Specificity
Broad expression. In adult eye expressed in sclera, retina, retinal pigment epithelium, and trabecular meshwork but not in choroid and iris.
Target Research Area
Developmental Biology
Target Synonyms
MCOPCB8; MCOPS9; PP14296; Stimulated by retinoic acid 6 homolog; Stimulated by retinoic acid gene 6 protein homolog; STRA6; STRA6_HUMAN
Target Background
The protein encoded by this gene is a membrane protein involved in the metabolism of retinol. The encoded protein acts as a receptor for retinol/retinol binding protein complexes. This protein removes the retinol from the complex and transports it across the cell membrane. Defects in this gene are a cause of syndromic microphthalmia type 9 (MCOPS9). Several transcript variants encoding a few different isoforms have been found for this gene.
Notification