Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STX10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 76-165 of human STX10 (NP_001258540.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STX10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 76-165 of human STX10 (NP_001258540.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06005A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STX10 |
| Target Synonyms | SYN10; hsyn10; STX10 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 76-165 of human STX10 (NP_001258540.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLR | Uniprot ID | O60499 |
Uniprot Id
O60499
Target Species
Human
Target Name
STX10
Target Full Name
Syntaxin-10
Target Function
SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type IV membrane protein.
Target Protein Families
Syntaxin family
Target Tissue Specificity
Expressed at high levels in heart, skeletal muscle and pancreas.
Target Research Area
Signal Transduction
Target Synonyms
STX10; SYN10; Syntaxin-10; Syn10
Target Background
This gene belongs to the syntaxin family and encodes a soluble N-ethylmaleimide sensitive factor attachment protein receptor (SNARE). The encoded protein is involved in docking and fusion events at the Golgi apparatus. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
