Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STYXL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human STYXL1 (NP_001304714.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STYXL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human STYXL1 (NP_001304714.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03283A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STYXL1 |
| Target Synonyms | DUSP24; MKSTYX; MK-STYX; STYXL1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A375 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human STYXL1 (NP_001304714.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLT | Uniprot ID | Q9Y6J8 |
Uniprot Id
Q9Y6J8
Target Species
Human
Target Name
STYXL1
Target Full Name
Serine/threonine/tyrosine-interacting-like protein 1
Target Function
Catalytically inactive phosphatase. By binding to G3BP1, inhibits the formation of G3BP1-induced stress granules. Does not act by protecting the dephosphorylation of G3BP1 at 'Ser-149'. Inhibits PTPMT1 phosphatase activity. By inhibiting PTPMT1, positively regulates intrinsic apoptosis. May play a role in the formation of neurites during neuronal development.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class subfamily
Target Synonyms
Dual specificity phosphatase inhibitor MK STYX; Dual specificity phosphatase inhibitor MK-STYX; Dual specificity protein phosphatase 24; DUSP24; Map kinase phosphatase like protein MK STYX; Map kinase phosphatase-like protein MK-STYX; MKSTYX; Serine/threonine/tyrosine interacting like protein 1; Serine/threonine/tyrosine-interacting-like protein 1; STYL1_HUMAN; STYXL1
Target Background
Enables protein phosphatase binding activity; protein phosphatase inhibitor activity; and pseudophosphatase activity. Involved in several processes, including negative regulation of phosphoprotein phosphatase activity; negative regulation of stress granule assembly; and positive regulation of intrinsic apoptotic signaling pathway. Located in mitochondrion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
