-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SUCLA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SUCLA2 (NP_003841.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SUCLA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SUCLA2 (NP_003841.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01204A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SUCLA2 |
| Target Synonyms | A-SCS; A-BETA; MTDPS5; LINC00444; SCS-betaA; SUCLA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, 293T, Mouse brain, Mouse liver, Rat liver, SW480 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SUCLA2 (NP_003841.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAASMFYGRLVAVATLRNHRPRTAQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGP | Uniprot ID | Q9P2R7 |
Uniprot Id
Q9P2R7
Target Species
Human
Target Name
SUCLA2
Target Full Name
Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
Target Function
ATP-specific succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA. The beta subunit provides nucleotide specificity of the enzyme and binds the substrate succinate, while the binding sites for coenzyme A and phosphate are found in the alpha subunit.
Target Involvement
Mitochondrial DNA depletion syndrome 5 (MTDPS5)
Target Subcellular Location
Mitochondrion.
Target Protein Families
Succinate/malate CoA ligase beta subunit family, ATP-specific subunit beta subfamily
Target Tissue Specificity
Widely expressed. Not expressed in liver and lung.
Target Research Area
Cardiovascular
Target Synonyms
A BETA; A SCS; ATP specific succinyl CoA synthetase subunit beta; ATP specific succinyl CoA synthetase, beta subunit; ATP-specific succinyl-CoA synthetase subunit beta; Mitochondrial succinyl CoA ligase [ADP forming] subunit beta; MTDPS5; Renal carcinoma antigen NY-REN-39; Renal carcinoma antigen NYREN39; SCS betaA; SCS-betaA; SUCB1_HUMAN; Succinate CoA ligase (ADP forming); Succinate CoA ligase [ADP forming] subunit beta, mitochondrial, succinyl CoA ligase [ADP forming] subunit beta, mitochondrial; Succinate CoA ligase ADP forming beta subunit; Succinate CoA ligase beta subunit; Succinyl CoA ligase [ADP-forming] subunit beta, mitochondrial; Succinyl CoA synthetase beta A chain; Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial; Succinyl-CoA synthetase beta-A chain; SUCLA2
Target Background
Succinyl-CoA synthetase (SCS) is a mitochondrial matrix enzyme that acts as a heterodimer, being composed of an invariant alpha subunit and a substrate-specific beta subunit. The protein encoded by this gene is an ATP-specific SCS beta subunit that dimerizes with the SCS alpha subunit to form SCS-A, an essential component of the tricarboxylic acid cycle. SCS-A hydrolyzes ATP to convert succinate to succinyl-CoA. Defects in this gene are a cause of myopathic mitochondrial DNA depletion syndrome. A pseudogene of this gene has been found on chromosome 6.
Notification