Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SULT1A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-295 of human SULT1A2 (NP_001045.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SULT1A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-295 of human SULT1A2 (NP_001045.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03284A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SULT1A2 |
| Target Synonyms | STP2; HAST4; P-PST; ST1A2; TSPST2; P-PST 2; SULT1A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 201-295 of human SULT1A2 (NP_001045.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL | Uniprot ID | P50226 |
Uniprot Id
P50226
Target Species
Human
Target Name
SULT1A2
Target Full Name
Sulfotransferase 1A2
Target Function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Is also responsible for the sulfonation and activation of minoxidil. Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Sulfotransferase 1 family
Target Synonyms
Aryl sulfotransferase 2; Arylamine sulfotransferase; HAST4; MGC142287; MGC142289; P PST; P-PST 2; Phenol preferring phenol sulfotransferase 2; Phenol sulfotransferase 2; Phenol-sulfating phenol sulfotransferase 2; Phenolic metabolizing (P) form of PST; ST1A2; ST1A2_HUMAN; STP2; Sulfotransferase 1A2; Sulfotransferase family cytosolic 1A phenol preferring member 2; SULT1A2; Thermostable phenol sulfotransferase; TSPST2
Target Background
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Two alternatively spliced variants that encode the same protein have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
