-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SULT1E1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-294 of human SULT1E1 (NP_005411.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SULT1E1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-294 of human SULT1E1 (NP_005411.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02501A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SULT1E1 |
| Target Synonyms | EST; STE; EST-1; ST1E1; SULT1E1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse testis, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 140-294 of human SULT1E1 (NP_005411.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI | Uniprot ID | P49888 |
Uniprot Id
P49888
Target Species
Human
Target Name
SULT1E1
Target Full Name
Sulfotransferase 1E1
Target Function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of estradiol and estrone. Is a key enzyme in estrogen homeostasis, the sulfation of estrogens leads to their inactivation. Also sulfates dehydroepiandrosterone (DHEA), pregnenolone, (24S)-hydroxycholesterol and xenobiotic compounds like ethinylestradiol, equalenin, diethyl stilbesterol and 1-naphthol at significantly lower efficiency. Does not sulfonate cortisol, testosterone and dopamine.
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
Sulfotransferase 1 family
Target Tissue Specificity
Liver, intestine and at lower level in the kidney.
Target Synonyms
EST; EST-1; EST1; Estrogen sulfotransferase; estrogen-preferring; estrone sulfotransferase; ST1E1; ST1E1_HUMAN; STE; Sulfotransferase 1E1; Sulfotransferase; Sulfotransferase estrogen preferring; Sulfotransferase family 1E member 1; SULT1E1
Target Background
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors.
Notification