-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SUPT4H1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human SUPT4H1 (NP_003159.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SUPT4H1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human SUPT4H1 (NP_003159.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09167A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SUPT4H1 |
| Target Synonyms | SPT4; SPT4H; SUPT4H; Supt4a; SUPT4H1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | B cells, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human SUPT4H1 (NP_003159.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT | Uniprot ID | P63272 |
Uniprot Id
P63272
Target Species
Human
Target Name
SUPT4H1
Target Full Name
Transcription elongation factor SPT4
Target Function
Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGTT/CAP1A. DSIF also acts cooperatively with the negative elongation factor complex (NELF complex) to enhance transcriptional pausing at sites proximal to the promoter. Transcriptional pausing may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF and NELF promote pausing by inhibition of the transcription elongation factor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II at transcription pause sites and stimulates the weak intrinsic nuclease activity of the enzyme. Cleavage of blocked transcripts by RNA polymerase II promotes the resumption of transcription from the new 3' terminus and may allow repeated attempts at transcription through natural pause sites. DSIF can also positively regulate transcriptional elongation and is required for the efficient activation of transcriptional elongation by the HIV-1 nuclear transcriptional activator, Tat. DSIF acts to suppress transcriptional pausing in transcripts derived from the HIV-1 LTR and blocks premature release of HIV-1 transcripts at terminator sequences.
Target Subcellular Location
Nucleus.
Target Protein Families
SPT4 family
Target Tissue Specificity
Widely expressed.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
DRB sensitivity-inducing factor 14 kDa subunit; DRB sensitivity-inducing factor small subunit; DSIF p14; DSIF small subunit; hSPT4; SPT4; SPT4H; SPT4H_HUMAN; SUPT4H `1; SUPT4H; Supt4h1; Transcription elongation factor spt4
Target Background
This gene encodes the small subunit of DRB (5, 6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene.
Notification