Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SUV420H1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human SUV420H1 (NP_060105.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SUV420H1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human SUV420H1 (NP_060105.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05056A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SUV420H1 |
| Target Synonyms | CGI85; MRD51; CGI-85; SUV420H1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7, Mouse lung, Mouse uterus, Rat uterus, SW480 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SUV420H1 (NP_060105.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNTSAFPSRSSRHFSKSDSFSHNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPC | Uniprot ID | Q4FZB7 |
Uniprot Id
Q4FZB7
Target Species
Human
Target Name
KMT5B
Target Full Name
Histone-lysine N-methyltransferase KMT5B
Target Function
Histone methyltransferase that specifically methylates monomethylated 'Lys-20' (H4K20me1) and dimethylated 'Lys-20' (H4K20me2) of histone H4 to produce respectively dimethylated 'Lys-20' (H4K20me2) and trimethylated 'Lys-20' (H4K20me3) and thus regulates transcription and maintenance of genome integrity. In vitro also methylates unmodified 'Lys-20' (H4K20me0) of histone H4 and nucleosomes. H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. Mainly functions in pericentric heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin in these regions. KMT5B is targeted to histone H3 via its interaction with RB1 family proteins (RB1, RBL1 and RBL2). Plays a role in myogenesis by regulating the expression of target genes, such as EID3. Facilitates TP53BP1 foci formation upon DNA damage and proficient non-homologous end-joining (NHEJ)-directed DNA repair by catalyzing the di- and trimethylation of 'Lys-20' of histone H4. May play a role in class switch reconbination by catalyzing the di- and trimethylation of 'Lys-20' of histone H4.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
Class V-like SAM-binding methyltransferase superfamily, Histone-lysine methyltransferase family, Suvar4-20 subfamily
Target Synonyms
CGI 85; CGI85; Histone-lysine N-methyltransferase KMT5B; Kmt5b; KMT5B_HUMAN; Lysine N-methyltransferase 5B; Lysine-specific methyltransferase 5B; MGC118906; MGC118909; MGC21161; MGC703; Su(var)4-20 homolog 1; Suppressor of variegation 4 20 homolog 1; Suppressor of variegation 4-20 homolog 1; Suv4-20h1
Target Background
This gene encodes a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
