-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SUZ12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human SUZ12 (Q15022) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against SUZ12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human SUZ12 (Q15022) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-13859A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SUZ12 |
| Target Synonyms | CHET9; IMMAS; JJAZ1; SUZ12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-29, MCF7, Mouse brain, Mouse lung, Rat lung | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human SUZ12 (Q15022). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQI | Uniprot ID | Q15022 |
Uniprot Id
Q15022
Target Species
Human
Target Name
SUZ12
Target Full Name
Polycomb protein SUZ12
Target Function
Polycomb group (PcG) protein. Component of the PRC2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. The PRC2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2 complex include HOXC8, HOXA9, MYT1 and CDKN2A.
Target Involvement
A chromosomal aberration involving SUZ12 may be a cause of endometrial stromal tumors. Translocation t(7;17)(p15;q21) with JAZF1. The translocation generates the JAZF1-SUZ12 oncogene consisting of the N-terminus part of JAZF1 and the C-terminus part of SUZ12. It is frequently found in all cases of endometrial stromal tumors, except in endometrial stromal sarcomas, where it is rarer.
Target Subcellular Location
Nucleus.
Target Protein Families
VEFS (VRN2-EMF2-FIS2-SU(Z)12) family
Target Tissue Specificity
Overexpressed in breast and colon cancer.
Target Synonyms
ChET 9 protein; CHET9; Chromatin precipitated E2F target 9 protein; JJAZ1; Joined to JAZF1 protein; KIAA0160; Polycomb protein SUZ12; Suppressor of zeste 12 homolog; Suppressor of zeste 12 protein homolog; SUZ12; SUZ12 polycomb repressive complex 2 subunit; SUZ12_HUMAN
Target Background
This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region.
Notification