-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Synapsin II was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human Synapsin II (Q92777) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Synapsin II was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human Synapsin II (Q92777) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14353A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Synapsin II |
| Target Synonyms | SYNII; Synapsin II | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human Synapsin II (Q92777). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HLIIGMQYAGLPSINSLESIYNFCDKPWVFAQLVAIYKTLGGEKFPLIEQTYYPNHKEMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQT | Uniprot ID | Q92777 |
Uniprot Id
Q92777
Target Species
Human
Target Name
SYN2
Target Full Name
Synapsin-2
Target Function
Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. May play a role in noradrenaline secretion by sympathetic neurons.
Target Involvement
Schizophrenia (SCZD)
Target Subcellular Location
Cell junction, synapse.
Target Protein Families
Synapsin family
Target Tissue Specificity
Central and peripheral nervous systems.
Target Synonyms
SYN2; Synapsin-2; Synapsin II
Target Background
This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family encodes a neuron-specific phosphoprotein that selectively binds to small synaptic vesicles in the presynaptic nerve terminal. Polymorphisms in this gene are associated with abnormal presynaptic function and related neuronal disorders, including autism, epilepsy, bipolar disorder and schizophrenia. Alternative splicing of this gene results in multiple transcript variants. The tissue inhibitor of metalloproteinase 4 gene is located within an intron of this gene and is transcribed in the opposite direction.
Notification