Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Syndecan 3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syndecan 3 (O75056) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Syndecan 3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syndecan 3 (O75056) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15908A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Syndecan 3 |
| Target Synonyms | SDCN; SYND3; Syndecan 3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, MCF7, Mouse lung, Mouse spleen, Rat lung, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syndecan 3 (O75056). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKPGPPHRAGAAHGAGAGAGAAAGPGARGLLLPPLLLLLLAGRAAGAQRWRSENFERPVDLEGSGDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFS | Uniprot ID | O75056 |
Uniprot Id
O75056
Target Species
Human
Target Name
SDC3
Target Full Name
Syndecan-3
Target Function
Cell surface proteoglycan that may bear heparan sulfate. May have a role in the organization of cell shape by affecting the actin cytoskeleton, possibly by transferring signals from the cell surface in a sugar-dependent mechanism.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Syndecan proteoglycan family
Target Tissue Specificity
Expressed in the nervous system, the adrenal gland, and the spleen.
Target Synonyms
SDC3; KIAA0468; Syndecan-3; SYND3
Target Background
The protein encoded by this gene belongs to the syndecan proteoglycan family. It may play a role in the organization of cell shape by affecting the actin cytoskeleton, possibly by transferring signals from the cell surface in a sugar-dependent mechanism. Allelic variants of this gene have been associated with obesity.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
