-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SYNJ1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human SYNJ1 (NP_003886.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SYNJ1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human SYNJ1 (NP_003886.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06949A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SYNJ1 |
| Target Synonyms | DEE53; EIEE53; INPP5G; PARK20; SYNJ1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Jurkat | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SYNJ1 (NP_003886.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNRFFWN | Uniprot ID | O43426 |
Uniprot Id
O43426
Target Species
Human
Target Name
SYNJ1
Target Full Name
Synaptojanin-1
Target Function
Phosphatase that acts on various phosphoinositides, including phosphatidylinositol 4-phosphate, phosphatidylinositol (4,5)-bisphosphate and phosphatidylinositol (3,4,5)-trisphosphate. Has a role in clathrin-mediated endocytosis. Hydrolyzes PIP2 bound to actin regulatory proteins resulting in the rearrangement of actin filaments downstream of tyrosine kinase and ASH/GRB2.
Target Involvement
Parkinson disease 20, early-onset (PARK20); Epileptic encephalopathy, early infantile, 53 (EIEE53)
Target Subcellular Location
Cytoplasm, perinuclear region.
Target Protein Families
Synaptojanin family; Inositol 1,4,5-trisphosphate 5-phosphatase family
Target Tissue Specificity
Concentrated at clathrin-coated endocytic intermediates in nerve terminals. Isoform 1 is more enriched than isoform 2 in developing brain as well as non-neuronal cells. Isoform 2 is very abundant in nerve terminals.
Target Synonyms
4; 5-trisphosphate 5-phosphatase 1; Inositol 5' phosphatase (synaptojanin 1); Inositol 5' phosphatase; INPP 5G; INPP5G; KIAA0910; PARK20; Polyphosphoinositide phosphatase; Synaptic inositol 1 4 5 trisphosphate 5 phosphatase 1; Synaptic inositol 145 trisphosphate 5 phosphatase 1; Synaptic inositol-1; Synaptojanin 1; Synaptojanin 1 polyphosphoinositide phosphatase; Synaptojanin-1; Synaptojanin1; Synj 1; Synj1; SYNJ1_HUMAN
Target Background
This gene encodes a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4, 5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification