Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SYNJ2BP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human SYNJ2BP (NP_060843.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SYNJ2BP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human SYNJ2BP (NP_060843.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05031A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SYNJ2BP |
| Target Synonyms | ARIP2; OMP25; SYNJ2BP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse small intestine, OVCAR3, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human SYNJ2BP (NP_060843.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMRYRQQL | Uniprot ID | P57105 |
Uniprot Id
P57105
Target Species
Human
Target Name
SYNJ2BP
Target Full Name
Synaptojanin-2-binding protein
Target Function
Regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction.
Target Subcellular Location
Mitochondrion outer membrane.
Target Synonyms
SYNJ2BP; OMP25; Synaptojanin-2-binding protein; Mitochondrial outer membrane protein 25
Target Background
Predicted to enable type II activin receptor binding activity. Involved in several processes, including negative regulation of endothelial cell migration; negative regulation of sprouting angiogenesis; and regulation of signal transduction. Located in mitochondrion. Is integral component of mitochondrial outer membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
