Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SYNPO was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 820-920 of human SYNPO (NP_001159680.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SYNPO was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 820-920 of human SYNPO (NP_001159680.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02144A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SYNPO |
| Target Synonyms | SYNPO | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 820-920 of human SYNPO (NP_001159680.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PIKEPAKVSPRAASPAKPSSLDLVPNLPKGALPPSPALPRPSRSSPGLYTSPGQDSLQPTAVSPPYGGDISPVSPSRAWSPRAKQAPRPSFSTRNAGIEAQ | Uniprot ID | Q8N3V7 |
Uniprot Id
Q8N3V7
Target Species
Human
Target Name
SYNPO
Target Full Name
Synaptopodin
Target Function
Actin-associated protein that may play a role in modulating actin-based shape and motility of dendritic spines and renal podocyte foot processes. Seems to be essential for the formation of spine apparatuses in spines of telencephalic neurons, which is involved in synaptic plasticity.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell junction, tight junction. Perikaryon. Cell projection, dendritic spine. Cell junction, synapse, postsynaptic density. Cell junction, synapse. Cytoplasm, cytosol.
Target Protein Families
Synaptopodin family
Target Tissue Specificity
Expressed in cerebral cortex.
Target Synonyms
KIAA1029; Synaptopodin; SYNPO; SYNPO_HUMAN
Target Background
Synaptopodin is an actin-associated protein that may play a role in actin-based cell shape and motility. The name synaptopodin derives from the protein's associations with postsynaptic densities and dendritic spines and with renal podocytes (Mundel et al., 1997 [PubMed 9314539]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
