Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SYT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SYT1(NP_005630.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SYT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SYT1(NP_005630.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08429A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SYT1 |
| Target Synonyms | SYT1; P65; SVP65; SYT; synaptotagmin-1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SYT1(NP_005630.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKN | Uniprot ID | P21579 |
Uniprot Id
P21579
Target Species
Human
Target Name
SYT1
Target Full Name
Synaptotagmin-1
Target Function
Calcium sensor that participates in triggering neurotransmitter release at the synapse. May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2. Plays a role in dendrite formation by melanocytes.
Target Involvement
A SYT1 rare mutation has been found in a child with a severe neuro-developmental disorder. The individual harboring this variant shows early onset dyskinetic movement disorder, severe motor delay and profound cognitive impairment, suggesting that SYT1 may play a role in the pathogenesis of this neuro-developmental disorder.
Target Subcellular Location
Cytoplasmic vesicle, secretory vesicle membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Single-pass membrane protein. Cytoplasm.
Target Protein Families
Synaptotagmin family
Target Tissue Specificity
Expressed in melanocytes.
Target Research Area
Neuroscience
Target Synonyms
DKFZp781D2042; FLJ42519; p65; SVP65; Synaptotagmin 2; Synaptotagmin I; Synaptotagmin II; Synaptotagmin-1; SYT; Syt1; SYT1_HUMAN; Syt2; SytI
Target Background
The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al., 2001 [PubMed 11242035]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
