Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SYT12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 95-200 of human SYT12 (NP_001171351.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SYT12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 95-200 of human SYT12 (NP_001171351.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02099A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SYT12 |
| Target Synonyms | SYT11; sytXII; SYT12 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 95-200 of human SYT12 (NP_001171351.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KGSLSIEDTFESISELGPLELMGRELDLAPYGTLRKSQSADSLNSISSVSNTFGQDFTLGQVEVSMEYDTASHTLNVAVMQGKDLLEREEASFESCFMRVSLLPDE | Uniprot ID | Q8IV01 |
Uniprot Id
Q8IV01
Target Species
Human
Target Name
SYT12
Target Full Name
Synaptotagmin-12
Target Function
Synaptic vesicle phosphoprotein that enhances spontaneous neurotransmitter release but does not effect induced neurotransmitter release. Unlike other synaptotagmins, it does not bind Ca(2+) or phospholipids. Essential for mossy-fiber long-term potentiation in the hippocampus.
Target Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass membrane protein.
Target Protein Families
Synaptotagmin family
Target Synonyms
SYT12; Synaptotagmin-12; Synaptotagmin XII; SytXII
Target Background
This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that mediate calcium-dependent regulation of membrane trafficking in synaptic transmission. Studies of the orthologous gene in rat have shown that the encoded protein selectively modulates spontaneous synaptic-vesicle exocytosis and may also be involved in regulating calcium independent secretion in nonneuronal cells. Alternative splicing results in multiple transcript variants. The gene has previously been referred to as synaptotagmin XI but has been renamed synaptotagmin XII to be standard with mouse and rat official nomenclature.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
