-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SYTL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 630-750 of human SYTL2 (NP_001156423) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SYTL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 630-750 of human SYTL2 (NP_001156423) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03233A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SYTL2 |
| Target Synonyms | EXO4; SLP2; SLP2A; SGA72M; CHR11SYT; PPP1R151; SYTL2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 630-750 of human SYTL2 (NP_001156423). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GNIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNEILRYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQL | Uniprot ID | Q9HCH5 |
Uniprot Id
Q9HCH5
Target Species
Human
Target Name
SYTL2
Target Full Name
Synaptotagmin-like protein 2
Target Function
Isoform 1 acts as a RAB27A effector protein and plays a role in cytotoxic granule exocytosis in lymphocytes. It is required for cytotoxic granule docking at the immunologic synapse. Isoform 4 binds phosphatidylserine (PS) and phosphatidylinositol-4,5-bisphosphate (PIP2) and promotes the recruitment of glucagon-containing granules to the cell membrane in pancreatic alpha cells. Binding to PS is inhibited by Ca(2+) while binding to PIP2 is Ca(2+) insensitive.
Target Subcellular Location
[Isoform 1]: Cytoplasm. Cell membrane.; [Isoform 4]: Cell membrane.
Target Tissue Specificity
Isoform 1 is expressed in hematopoietic lineages with a strong expression in CD4 and CD8 T-lymphocytes. It is also widely expressed in nonhematopoietic tissues. Isoform 5 is expressed only in nonhematopoietic tissues. Isoform 4 is expressed in pancreatic
Target Synonyms
Breast cancer-associated antigen SGA-72M; CHR11SYT; EXO4; Exophilin-4; FLJ20163; FLJ21219; KIAA1597; MGC102768; SGA72M; SLP2; SLP2A; Synaptotagmin-like protein 2; SYTL2; SYTL2_HUMAN
Target Background
The protein encoded by this gene is a synaptotagmin-like protein (SLP) that belongs to a C2 domain-containing protein family. The SLP homology domain (SHD) of this protein has been shown to specifically bind the GTP-bound form of Ras-related protein Rab-27A (RAB27A). This protein plays a role in RAB27A-dependent vesicle trafficking and controls melanosome distribution in the cell periphery. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification