-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-121 of human TAC3 (NP_037383.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TAC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-121 of human TAC3 (NP_037383.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03094A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAC3 |
| Target Synonyms | NK3; NKB; HH10; NKNB; PRO1155; ZNEUROK1; LncZBTB39; TAC3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Jurkat, Mouse brain, Mouse spleen, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-121 of human TAC3 (NP_037383.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE | Uniprot ID | Q9UHF0 |
Uniprot Id
Q9UHF0
Target Species
Human
Target Name
TAC3
Target Full Name
Tachykinin-3
Target Function
Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Is a critical central regulator of gonadal function.
Target Involvement
Hypogonadotropic hypogonadism 10 with or without anosmia (HH10)
Target Subcellular Location
Secreted.
Target Protein Families
Tachykinin family
Target Synonyms
Gamma tachykinin 3; Neurokinin B; Neurokinin B like protein; Neurokinin B protein; Neurokinin beta; Neurokinin-B; NeurokininB; Neuromedin K; Neuromedin-K; NeuromedinK; NKB; NKNB ; Preprotachykinin B; PreprotachykininB; PRO 1155; PRO1155 ; TAC 3; TAC3; Tachykinin 3; Tachykinin3; TKNK_HUMAN; ZNEUROK 1; ZNEUROK1
Target Background
This gene encodes a member of the tachykinin family of secreted neuropeptides. The encoded preproprotein is proteolytically processed to generate the mature peptide, which is primarily expressed in the central and peripheral nervous systems and functions as a neurotransmitter. This peptide is the ligand for the neurokinin-3 receptor. This protein is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. Mutations in this gene are associated with normosmic hypogonadotropic hypogonadism. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
Notification