-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TACC3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TACC3 (NP_006333.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TACC3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TACC3 (NP_006333.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14388A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TACC3 |
| Target Synonyms | ERIC1; Tacc4; ERIC-1; maskin; TACC3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TACC3 (NP_006333.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQK | Uniprot ID | Q9Y6A5 |
Uniprot Id
Q9Y6A5
Target Species
Human
Target Name
TACC3
Target Full Name
Transforming acidic coiled-coil-containing protein 3
Target Function
Plays a role in the microtubule-dependent coupling of the nucleus and the centrosome. Involved in the processes that regulate centrosome-mediated interkinetic nuclear migration (INM) of neural progenitors. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge. The TACC3/ch-TOG/clathrin complex is required for the maintenance of kinetochore fiber tension. May be involved in the control of cell growth and differentiation. May contribute to cancer.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Cytoplasm, cytoskeleton, spindle pole.
Target Protein Families
TACC family
Target Synonyms
ERIC 1; ERIC-1; ERIC1; MGC117382; MGC133242; OTTHUMP00000113796; TACC3; TACC3_HUMAN; Transforming acidic coiled coil containing protein 3; Transforming acidic coiled-coil-containing protein 3
Target Background
This gene encodes a member of the transforming acidic colied-coil protein family. The encoded protein is a motor spindle protein that may play a role in stabilization of the mitotic spindle. This protein may also play a role in growth a differentiation of certain cancer cells.
Notification