Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TACR3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 356-465 of human TACR3 (NP_001050.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TACR3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 356-465 of human TACR3 (NP_001050.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11047A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TACR3 |
| Target Synonyms | NK3; NKR; HH11; NK3R; NK-3R; TAC3R; TAC3RL; TACR3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60, Human placenta | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 356-465 of human TACR3 (NP_001050.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YCCLNKRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADTTRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS | Uniprot ID | P29371 |
Uniprot Id
P29371
Target Species
Human
Target Name
TACR3
Target Full Name
Neuromedin-K receptor
Target Function
This is a receptor for the tachykinin neuropeptide neuromedin-K (neurokinin B). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: neuromedin-K > substance K > substance P.
Target Involvement
Hypogonadotropic hypogonadism 11 with or without anosmia (HH11)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Synonyms
TACR3; NK3R; TAC3R; Neuromedin-K receptor; NKR; NK-3 receptor; NK-3R; Neurokinin B receptor; Tachykinin receptor 3
Target Background
This gene belongs to a family of genes that function as receptors for tachykinins. Receptor affinities are specified by variations in the 5'-end of the sequence. The receptors belonging to this family are characterized by interactions with G proteins and 7 hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin neurokinin 3, also referred to as neurokinin B.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
