-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAF12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human TAF12 (NP_001128690.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TAF12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human TAF12 (NP_001128690.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13580A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAF12 |
| Target Synonyms | TAF2J; TAFII20; 12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human TAF12 (NP_001128690.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK | Uniprot ID | Q16514 |
Uniprot Id
Q16514
Target Species
Human
Target Name
TAF12
Target Full Name
Transcription initiation factor TFIID subunit 12
Target Function
TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription.
Target Subcellular Location
Nucleus.
Target Protein Families
TAF12 family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
TAF12; TAF12 RNA polymerase II; TATA box binding protein (TBP)-associated factor; 20kDa; TAF12_HUMAN; TAF15; TAF2J; TAFII 20/TAFII 15; TAFII-20/TAFII-15; TAFII20 ; TAFII20/TAFII15; Transcription initiation factor TFIID 20/15 kDa subunits; Transcription initiation factor TFIID subunit 12
Target Background
Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I. Two transcript variants encoding the same protein have been found for this gene.
Notification