-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 242-331 of human TAL1 (NP_003180.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TAL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 242-331 of human TAL1 (NP_003180.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03339A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAL1 |
| Target Synonyms | SCL; TCL5; tal-1; bHLHa17; TAL1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HT-29, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 242-331 of human TAL1 (NP_003180.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR | Uniprot ID | P17542 |
Uniprot Id
P17542
Target Species
Human
Target Name
TAL1
Target Full Name
T-cell acute lymphocytic leukemia protein 1
Target Function
Implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. Serves as a positive regulator of erythroid differentiation.
Target Involvement
A chromosomal aberration involving TAL1 may be a cause of some T-cell acute lymphoblastic leukemias (T-ALL). Translocation t(1;14)(p32;q11) with T-cell receptor alpha chain (TCRA) genes.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Leukemic stem cell.
Target Synonyms
bHLHa17; Class A basic helix-loop-helix protein 17; OTTHUMP00000009563; OTTHUMP00000009564; SCL; STEM CELL LEUKEMIA HEMATOPOIETIC TRANSCRIPTION FACTOR; Stem cell protein; T cell acute lymphocytic leukemia 1; T cell acute lymphocytic leukemia 1 protein ; T cell acute lymphocytic leukemia 1 protein; T cell leukemia/lymphoma 5 protein; T-cell acute lymphocytic leukemia protein 1; T-cell leukemia/lymphoma protein 5; Tal 1; Tal 1 product; TAL 1 protein; TAL bHLH transcription factor 1 erythroid differentiation factor; TAL-1; tal1; TAL1_HUMAN; TCL 5; TCL5
Target Background
Enables several functions, including DNA-binding transcription factor activity; E-box binding activity; and histone deacetylase binding activity. Involved in several processes, including myeloid cell differentiation; positive regulation of cellular component organization; and positive regulation of erythrocyte differentiation. Located in chromatin and nucleoplasm. Part of transcription regulator complex. Implicated in acute lymphoblastic leukemia.
Notification