-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAOK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 900-985 of human TAOK1 (NP_065842.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TAOK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 900-985 of human TAOK1 (NP_065842.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14595A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAOK1 |
| Target Synonyms | DDIB; PSK2; TAO1; KFC-B; MARKK; PSK-2; hKFC-B; hTAOK1; MAP3K16; TAOK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse testis, Rat liver, U-251 MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 900-985 of human TAOK1 (NP_065842.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRS | Uniprot ID | Q7L7X3 |
Uniprot Id
Q7L7X3
Target Species
Human
Target Name
TAOK1
Target Full Name
Serine/threonine-protein kinase TAO1
Target Function
Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. Involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. Acts as a regulator of cytoskeleton stability by phosphorylating 'Thr-208' of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. Also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily
Target Tissue Specificity
Highly expressed in the testis, and to a lower extent also expressed in brain, placenta, colon and skeletal muscle.
Target Synonyms
2810468K05Rik; AU020252; D130018F14Rik; EC 2.7.11.1; FLJ14314; hKFC B; hKFC-B; KIAA1361; Kinase from chicken homolog B; MAP3K16; MARK kinase; MARKK; MGC29021; Microtubule affinity regulating kinase kinase; mKIAA1361; Prostate-derived sterile 20-like kinase 2; PSK2; Serine/threonine kinase TAO1; Serine/threonine protein kinase TAO1 ; Serine/threonine protein kinase TAO1 homolog; Serine/threonine-protein kinase TAO1; STE20 like kinase ; STE20 like kinase PSK2 ; STE20-like kinase PSK2; TAO kinase 1; Taok1; TAOK1_HUMAN; Thousand and one amino acid protein 1
Target Background
Enables alpha-tubulin binding activity; beta-tubulin binding activity; and kinase activity. Involved in several processes, including mitotic G2 DNA damage checkpoint signaling; negative regulation of microtubule depolymerization; and positive regulation of JNK cascade. Located in microtubule cytoskeleton and perinuclear region of cytoplasm.
Notification