Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAS1R2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human TAS1R2 (NP_689418.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TAS1R2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human TAS1R2 (NP_689418.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09241A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAS1R2 |
| Target Synonyms | TR2; T1R2; GPR71; TAS1R2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, MCF7 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 450-550 of human TAS1R2 (NP_689418.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IVQWQWDRSQNPFQSVASYYPLQRQLKNIQDISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPNNEWSYQSETS | Uniprot ID | Q8TE23 |
Uniprot Id
Q8TE23
Target Species
Human
Target Name
TAS1R2
Target Full Name
Taste receptor type 1 member 2
Target Function
Putative taste receptor. TAS1R2/TAS1R3 recognizes diverse natural and synthetic sweeteners.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 3 family, TAS1R subfamily
Target Research Area
Neuroscience
Target Synonyms
G protein coupled receptor 71; G-protein coupled receptor 71; GPR71; Sweet taste receptor T1R2; T1R2; TAS1R2; Taste receptor type 1 member 2; TR2; TS1R2_HUMAN
Target Background
Contributes to sweet taste receptor activity. Involved in detection of chemical stimulus involved in sensory perception of sweet taste and positive regulation of cytokinesis. Part of sweet taste receptor complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
